Rab10

Plasmid
pET15b 6His sumo Rab10 T73E
Parent Plasmid
pET15b 6His SUMO1
Expressed
6His sumo Rab10 T73E
DU Number
DU51064
Genbank
NM_016131.4 GI:256222018
Tag
6His
SUMO
Species
Human
Amino Acid Sequence
MGHHHHHHSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQE
QTGGMAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQERFHEITTSYYRGAMGIMLVYDITNGKS
FENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKGKGEQIAREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPNSENVDISSGGGVTGWK
SKCC*
Vector Type
Bacterial
Antibiotic
Amp
100042 R 1000 1001 1047 19007
Enquire Now