RAB12

Plasmid
pCMV5 HA RAB12 T56N
Parent Plasmid
pCMV5 HA1
Expressed
HA-RAB12 T56N
DU Number
DU48982
Genbank
NM_001025300.2
Tag
HA
Species
Human
Sequence of Insert
GAATTCATGGATCCGGGCGCCGCGCTGCAGAGGCGGGCCGGGGGCGGCGGCGGTCTGGGCGCGGGCTCCCCGGCGCTGTCGGGCGGCCAGGGCCGCCGGAGGAAGCAGCCCCCCAGGCCGGCCGACTTCAAGTTGCAGGTCATCATTATCGGCTCCCGCGGCGTGGGCAAGAACAGCCTGATGGAGCGCTTCACCGACGACACCTTCTGCGAGGCCTGCAAGTCCACCGTGGGTGTTGACTTCAAAATCAAAACTGTAGAGCTAAGAGGAAAGAAAATTAGATTACAGATCTGGGACACAGCAGGTCAGGAGAGATTCAACAGCATTACCTCAGCTTATTACAGAAGTGCCAAGGGGATCATATTAGTATATGATATCACTAAGAAGGAGACATTTGATGATTTGCCGAAATGGATGAAGATGATTGATAAGTATGCTTCAGAAGATGCAGAGCTTCTCTTAGTTGGAAATAAGTTGGACTGTGAAACGGACAGAGAAATCACCAGGCAGCAGGGGGAAAAGTTTGCACAGCAGATCACTGGGATGCGGTTCTGTGAAGCAAGTGCCAAGGATAACTTCAATGTGGACGAGATATTTTTGAAACTTGTCGATGACATTCTGAAAAAGATGCCTCTGGATATTTTAAGGAATGAGTTGTCCAATAGTATCCTGTCGTTACAACCAGAGCCTGAGATACCGCCAGAACTGCCTCCACCAAGACCACATGTCCGATGCTGTTGACCGGCCGC

Amino Acid Sequence
MYPYDVPDYAGSPEFMDPGAALQRRAGGGGGLGAGSPALSGGQGRRRKQP
PRPADFKLQVIIIGSRGVGKNSLMERFTDDTFCEACKSTVGVDFKIKTVE
LRGKKIRLQIWDTAGQERFNSITSAYYRSAKGIILVYDITKKETFDDLPK
WMKMIDKYASEDAELLLVGNKLDCETDREITRQQGEKFAQQITGMRFCEA
SAKDNFNVDEIFLKLVDDILKKMPLDILRNELSNSILSLQPEPEIPPELP
PPRPHVRCC*
Vector Type
Mammalian
Antibiotic
Amp
Comments
T56N
100042 R 1000 1001 1047 19007
Enquire Now