RAB33B

Synonyms
SMC2
Plasmid
pCMV5D FLAG RAB33B
Parent Plasmid
pCMV5D FLAG
Expressed
FLAG-RAB33B
DU Number
DU48599
Genbank
NM_031296.1
Tag
FLAG
Species
Human
Sequence of Insert
GGATCCGCCATGGCTGAGGAGATGGAGTCGTCGCTCGAGGCAAGCTTTTCGTCCAGCGGGGCAGTGTCAGGGGCCTCAGGGTTTTTGCCTCCTGCCCGCTCCCGCATCTTCAAGATAATCGTGATCGGCGACTCCAATGTGGGCAAGACATGCCTGACCTACCGCTTCTGCGCTGGCCGCTTCCCCGACCGCACCGAGGCCACGATAGGGGTGGATTTCCGAGAACGAGCGGTGGAGATTGATGGGGAGCGCATCAAGATCCAGCTATGGGACACAGCAGGACAAGAACGATTCAGAAAGAGCATGGTTCAGCACTACTACAGAAATGTACATGCTGTTGTCTTCGTGTATGATATGACCAACATGGCTAGTTTTCATAGCCTACCATCTTGGATAGAAGAATGCAAACAACATTTGCTAGCCAATGATATACCACGGATTCTTGTTGGAAATAAATGTGACTTGAGAAGTGCCATACAGGTACCCACAGACTTGGCACAAAAATTTGCTGACACACACAGTATGCCTTTGTTTGAAACGTCTGCTAAAAACCCCAATGATAATGACCATGTGGAAGCTATATTTATGACCTTGGCTCATAAGCTTAAGAGCCACAAACCATTAATGCTTAGTCAGCCCCCTGATAATGGAATTATCCTGAAGCCTGAACCAAAGCCTGCAATGACGTGCTGGTGCTAAGCGGCCGC

Amino Acid Sequence
MDYKDDDDKGSAMAEEMESSLEASFSSSGAVSGASGFLPPARSRIFKIIV
IGDSNVGKTCLTYRFCAGRFPDRTEATIGVDFRERAVEIDGERIKIQLWD
TAGQERFRKSMVQHYYRNVHAVVFVYDMTNMASFHSLPSWIEECKQHLLA
NDIPRILVGNKCDLRSAIQVPTDLAQKFADTHSMPLFETSAKNPNDNDHV
EAIFMTLAHKLKSHKPLMLSQPPDNGIILKPEPKPAMTCWC*
Vector Type
Mammalian
Antibiotic
Amp
100042 R 1000 1001 1047 19007
Enquire Now