RAB33B

Synonyms
SMC2
Plasmid
pSCB RAB33B Bam Not
Parent Plasmid
pSC-B
DU Number
DU48578
Genbank
NM_031296.1
Species
Human
Sequence of Insert
GGATCCGCCATGGCTGAGGAGATGGAGTCGTCGCTCGAGGCAAGCTTTTCGTCCAGCGGGGCAGTGTCAGGGGCCTCAGGGTTTTTGCCTCCTGCCCGCTCCCGCATCTTCAAGATAATCGTGATCGGCGACTCCAATGTGGGCAAGACATGCCTGACCTACCGCTTCTGCGCTGGCCGCTTCCCCGACCGCACCGAGGCCACGATAGGGGTGGATTTCCGAGAACGAGCGGTGGAGATTGATGGGGAGCGCATCAAGATCCAGCTATGGGACACAGCAGGACAAGAACGATTCAGAAAGAGCATGGTTCAGCACTACTACAGAAATGTACATGCTGTTGTCTTCGTGTATGATATGACCAACATGGCTAGTTTTCATAGCCTACCATCTTGGATAGAAGAATGCAAACAACATTTGCTAGCCAATGATATACCACGGATTCTTGTTGGAAATAAATGTGACTTGAGAAGTGCCATACAGGTACCCACAGACTTGGCACAAAAATTTGCTGACACACACAGTATGCCTTTGTTTGAAACGTCTGCTAAAAACCCCAATGATAATGACCATGTGGAAGCTATATTTATGACCTTGGCTCATAAGCTTAAGAGCCACAAACCATTAATGCTTAGTCAGCCCCCTGATAATGGAATTATCCTGAAGCCTGAACCAAAGCCTGCAATGACGTGCTGGTGCTAAGCGGCCGC

Amino Acid Sequence
MAEEMESSLEASFSSSGAVSGASGFLPPARSRIFKIIVIGDSNVGKTCLT
YRFCAGRFPDRTEATIGVDFRERAVEIDGERIKIQLWDTAGQERFRKSMV
QHYYRNVHAVVFVYDMTNMASFHSLPSWIEECKQHLLANDIPRILVGNKC
DLRSAIQVPTDLAQKFADTHSMPLFETSAKNPNDNDHVEAIFMTLAHKLK
SHKPLMLSQPPDNGIILKPEPKPAMTCWC*
Vector Type
Other
Antibiotic
Amp
100042 R 1000 1001 1047 19007
Enquire Now