Rab8b

Plasmid
pMAL4C RAB8b T22N
Parent Plasmid
pMAL4C
Expressed
MBP-Rab8b T22N
DU Number
DU43962
Genbank
Q92930
Tag
MBP
Species
Human
Sequence of Insert
GGATCCATGGCGAAGACGTACGATTATCTCTTCAAGCTCCTGCTGATCGG
CGACTCGGGGGTAGGCAAGAACTGCCTCCTGTTCCGCTTCTCAGAGGACG
CCTTCAACACCACCTTCATCTCCACCATCGGAATTGATTTTAAAATTAGA
ACGATAGAACTAGATGGAAAGAAAATTAAGCTTCAGATATGGGACACAGC
GGGTCAGGAAAGATTCCGAACAATCACGACAGCGTACTACAGAGGAGCCA
TGGGCATTATGCTGGTCTATGACATCACAAATGAAAAATCCTTTGACAAT
ATTAAAAATTGGATCAGAAACATTGAAGAGCATGCCTCTTCCGATGTCGA
AAGAATGATCCTGGGTAACAAATGTGATATGAATGACAAAAGACAAGTGT
CAAAAGAAAGAGGGGAGAAGCTAGCAATTGACTATGGGATTAAATTCTTG
GAGACAAGCGCAAAATCCAGTGCAAATGTAGAAGAGGCATTTTTTACACT
TGCACGAGATATAATGACAAAACTCAACAGAAAAATGAATGACAGCAATT
CAGCAGGAGCAGGTGGACCAGTGAAAATAACAGAAAACCGATCAAAGAAG
ACCAGTTTCTTTCGTTGCTCGCTACTTTGAGCGGCCGC
Amino Acid Sequence
MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQ
VAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRY
NGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMF
NLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLI
KNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPT
FKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPL
GAVALKSYEEELVKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVIN
AASGRQTVDEALKDAQTNSSSNNNNNNNNNNLGDDDDKVPEFLEVLFQGP
GSMAKTYDYLFKLLLIGDSGVGKNCLLFRFSEDAFNTTFISTIGIDFKIR
TIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDN
IKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFL
ETSAKSSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGPVKITENRSKK
TSFFRCSLL*
Vector Type
Bacterial
Antibiotic
Amp
Comments
Please make point mutation T22N within Rab8b in DU 43885
100042 R 1000 1001 1047 19007
Enquire Now