Rab8a

Plasmid
pMAL4C Rab8a S111A
Parent Plasmid
pMAL4C
Expressed
MBP-Rab8a [Ser111Ala mutant]
DU Number
DU43884
Genbank
NM_005370.4 GI:40548385
Tag
MBP
Species
Human
Sequence of Insert
GGATCCATGGCGAAGACCTACGATTACCTGTTCAAGCTGCTGCTGATCGG
GGACTCGGGGGTGGGGAAGACCTGTGTCCTGTTCCGCTTCTCCGAGGACG
CCTTCAACTCCACTTTTATCTCCACCATAGGAATTGACTTTAAAATTAGG
ACCATAGAGCTCGATGGCAAGAGAATTAAACTGCAGATATGGGACACAGC
CGGTCAGGAACGGTTTCGGACGATCACAACGGCCTACTACAGGGGTGCAA
TGGGCATCATGCTGGTCTACGACATCACCAACGAGAAGTCCTTCGACAAC
ATCCGGAACTGGATTCGCAACATTGAGGAGCACGCCGCTGCAGACGTCGA
AAAGATGATACTCGGGAACAAGTGTGATGTGAATGACAAGAGACAAGTTT
CCAAGGAACGGGGAGAAAAGCTGGCCCTCGACTATGGAATCAAGTTCATG
GAGACCAGCGCGAAGGCCAACATCAATGTGGAAAATGCATTTTTCACTCT
CGCCAGAGATATCAAAGCAAAAATGGACAAAAAATTGGAAGGCAACAGCC
CCCAGGGGAGCAACCAGGGAGTCAAAATCACACCGGACCAGCAGAAGAGG
AGCAGCTTTTTCCGATGTGTTCTTCTGTGAGCGGCCGC
Amino Acid Sequence
MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQ
VAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRY
NGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMF
NLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLI
KNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPT
FKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPL
GAVALKSYEEELVKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVIN
AASGRQTVDEALKDAQTNSSSNNNNNNNNNNLGDDDDKVPEFLEVLFQGP
GSMAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIR
TIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDN
IRNWIRNIEEHAAADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFM
ETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKR
SSFFRCVLL*
Vector Type
Bacterial
Antibiotic
Amp
Comments
in pMal4c
100042 R 1000 1001 1047 19007
Enquire Now