RAB39B

Plasmid
pcDNA5FRTTO GST Rab39b
Parent Plasmid
pcDNA5D FRT/TO GST
Expressed
GST-RAB39B
DU Number
DU43847
Genbank
Q96DA2
Tag
GST
Species
Human
Sequence of Insert
ggatccatggaggccatctggctgtaccagttccggctcattgtcatcgg
ggattccacagtgggcaagtcctgcctgatccgccgcttcaccgagggtc
gctttgcccaggtttctgaccccaccgtgggggtggattttttctcccgc
ttggtggagatcgagccaggaaaacgcatcaagctccagatctgggatac
cgcgggtcaagagaggttcagatccatcactcgcgcctactacaggaact
cagtaggtggtcttctcttatttgacattaccaaccgcaggtccttccag
aatgtccatgagtggttagaagagaccaaagtacacgttcagccctacca
aattgtatttgttctggtgggtcacaagtgtgacctggatacacagaggc
aagtgactcgccacgaggccgagaaactggctgctgcatacggcatgaag
tacattgaaacgtcagcccgagatgccattaatgtggagaaagccttcac
agacctgacaagagacatatatgagctggttaaaaggggggagattacaa
tccaggagggctgggaaggggtgaagagtggatttgtaccaaatgtggtt
cactcttcagaagaggttgtcaaatcagagaggagatgtttgtgctaggc
gccgc
Amino Acid Sequence
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL
EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL
DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH
PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA
WPLQGWQATFGGGDHPPKSDLEVLFQGPLGSMEAIWLYQFRLIVIGDSTV
GKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDTAGQE
RFRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWLEETKVHVQPYQIVFV
LVGHKCDLDTQRQVTRHEAEKLAAAYGMKYIETSARDAINVEKAFTDLTR
DIYELVKRGEITIQEGWEGVKSGFVPNVVHSSEEVVKSERRCLC*
Vector Type
Mammalian
Antibiotic
Amp
Comments
in pcDNA5FRT/TO vector
100042 R 1000 1001 1047 19007
Enquire Now