RAB39B

Plasmid
pET6HIS SUMO RAB39b + linker
Parent Plasmid
pET15b 6His SUMO1
Expressed
His-SUMO-RAB39B + linker
DU Number
DU43846
Genbank
Q96DA2
Tag
6His
SUMO
Species
Human
Sequence of Insert
GGATCCatggaggccatctggctgtaccagttccggctcattgtcatcgg
ggattccacagtgggcaagtcctgcctgatccgccgcttcaccgagggtc
gctttgcccaggtttctgaccccaccgtgggggtggattttttctcccgc
ttggtggagatcgagccaggaaaacgcatcaagctccagatctgggatac
cgcgggtcaagagaggttcagatccatcactcgcgcctactacaggaact
cagtaggtggtcttctcttatttgacattaccaaccgcaggtccttccag
aatgtccatgagtggttagaagagaccaaagtacacgttcagccctacca
aattgtatttgttctggtgggtcacaagtgtgacctggatacacagaggc
aagtgactcgccacgaggccgagaaactggctgctgcatacggcatgaag
tacattgaaacgtcagcccgagatgccattaatgtggagaaagccttcac
agacctgacaagagacatatatgagctggttaaaaggggggagattacaa
tccaggagggctgggaaggggtgaagagtggatttgtaccaaatgtggtt
cactcttcagaagaggttgtcaaatcagagaggagatgtttgtgctaggc
ggccgc
Amino Acid Sequence
MGHHHHHHSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTH
LKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQE
QTGGSMEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDF
FSRLVEIEPGKRIKLQIWDTAGQERFRSITRAYYRNSVGGLLLFDITNRR
SFQNVHEWLEETKVHVQPYQIVFVLVGHKCDLDTQRQVTRHEAEKLAAAY
GMKYIETSARDAINVEKAFTDLTRDIYELVKRGEITIQEGWEGVKSGFVP
NVVHSSEEVVKSKRRCLC*
Vector Type
Bacterial
Antibiotic
Amp
Comments
in pET vector
100042 R 1000 1001 1047 19007
Enquire Now