RAB39B

Plasmid
pGEX6P-1 RAB39b
Parent Plasmid
pGEX6P1
Expressed
GST-RAB39B
DU Number
DU43849
Genbank
Q96DA2
Tag
GST
Species
Human
Sequence of Insert
GGATCCatggaggccatctggctgtaccagttccggctcattgtcatcgg
ggattccacagtgggcaagtcctgcctgatccgccgcttcaccgagggtc
gctttgcccaggtttctgaccccaccgtgggggtggattttttctcccgc
ttggtggagatcgagccaggaaaacgcatcaagctccagatctgggatac
cgcgggtcaagagaggttcagatccatcactcgcgcctactacaggaact
cagtaggtggtcttctcttatttgacattaccaaccgcaggtccttccag
aatgtccatgagtggttagaagagaccaaagtacacgttcagccctacca
aattgtatttgttctggtgggtcacaagtgtgacctggatacacagaggc
aagtgactcgccacgaggccgagaaactggctgctgcatacggcatgaag
tacattgaaacgtcagcccgagatgccattaatgtggagaaagccttcac
agacctgacaagagacatatatgagctggttaaaaggggggagattacaa
tccaggagggctgggaaggggtgaagagtggatttgtaccaaatgtggtt
cactcttcagaagaggttgtcaaatcagagaggagatgtttgtgctagGC
GGCCGC
Amino Acid Sequence
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL
EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL
DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH
PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA
WPLQGWQATFGGGDHPPKSDLEVLFQGPLGSMEAIWLYQFRLIVIGDSTV
GKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDTAGQE
RFRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWLEETKVHVQPYQIVFV
LVGHKCDLDTQRQVTRHEAEKLAAAYGMKYIETSARDAINVEKAFTDLTR
DIYELVKRGEITIQEGWEGVKSGFVPNVVHSSEEVVKSERRCLC*
Vector Type
Bacterial
Antibiotic
Amp
Comments
Consider shorter induction time if does not express under standard conditions
100042 R 1000 1001 1047 19007
Enquire Now