Rab12 (mouse)

Plasmid
pCMVHA-1 RAB12 (mouse)
Parent Plasmid
pCMV5 HA1
Expressed
HA-Rab12
DU Number
DU43975
Genbank
NM_024448.2
Tag
HA
Species
Mouse
Sequence of Insert
GGATCCCAGCGCCGCGCTGCACCGGCGGCCCGCGGGCGGCAGCCTGGGCG
CGGTCTCCCCGGCGCTGTCGGGCGGCCAGGCCCGCCGGAGGAAGCAGCCC
CCCAGGCCGGCCGACTTCAAGCTGCAGGTCATCATCATCGGCTCCCGCGG
CGTGGGCAAGACCAGCCTGATGGAGCGCTTCACCGACGACACGTTCTGCG
AGGCCTGCAAGTCCACCGTGGGTGTTGACTTTAAAATCAAGACTGTAGAA
CTAAGAGGGAAGAAAATTAGATTACAGATCTGGGACACAGCAGGGCAGGA
GCGATTTAACAGCATTACCTCAGCCTATTACAGAAGTGCCAAGGGGATCA
TACTCGTATATGACATCACCAAGAAGGAGACGTTCGATGACTTGCCAAAG
TGGATGAAGATGATTGACAAGTATGCTTCAGAAGACGCCGAGCTCCTCCT
GGTTGGAAATAAGCTGGACTGTGAGACAGACAGAGAAATCTCAAGGCAGC
AAGGAGAAAAGTTTGCACAGCAGATAACCGGGATGCGCTTCTGCGAAGCC
AGTGCCAAGGACAATTTCAATGTGGACGAGATCTTTCTGAAACTTGTTGA
TGATATTCTGAAAAAGATGCCTCTTGATGTTTTGAGAAACGAGTTATCCA
ATAGCATCCTTTCTCTACAACCAGAGCCTGAGATCCCACCAGAGCTGCCT
CCTCCCAGACCACACGTCCGATGCTGTTGAGCggccgc
Amino Acid Sequence
MYPYDVPDYAGSPEMDPSAALHRRPAGGSLGAVSPALSGGQARRRKQPPR
PADFKLQVIIIGSRGVGKTSLMERFTDDTFCEACKSTVGVDFKIKTVELR
GKKIRLQIWDTAGQERFNSITSAYYRSAKGIILVYDITKKETFDDLPKWM
KMIDKYASEDAELLLVGNKLDCETDREISRQQGEKFAQQITGMRFCEASA
KDNFNVDEIFLKLVDDILKKMPLDVLRNELSNSILSLQPEPEIPPELPPP
RPHVRCC*
Vector Type
Mammalian
Antibiotic
Amp
100042 R 1000 1001 1047 19007
Enquire Now