Rab8b

Plasmid
pCMVHA RAB8b Q67L
Parent Plasmid
pCMV5 HA1
Expressed
HA-Rab8b Q67L
DU Number
DU43637
Genbank
Q92930
Tag
HA
Species
Human
Sequence of Insert
GGATCCATGGCGAAGACGTACGATTATCTCTTCAAGCTCCTGCTGATCGG
CGACTCGGGGGTAGGCAAGACCTGCCTCCTGTTCCGCTTCTCAGAGGACG
CCTTCAACACCACCTTCATCTCCACCATCGGAATTGATTTTAAAATTAGA
ACGATAGAACTAGATGGAAAGAAAATTAAGCTTCAGATATGGGACACAGC
GGGTCTGGAAAGATTCCGAACAATCACGACAGCGTACTACAGAGGAGCCA
TGGGCATTATGCTGGTCTATGACATCACAAATGAAAAATCCTTTGACAAT
ATTAAAAATTGGATCAGAAACATTGAAGAGCATGCCTCTTCCGATGTCGA
AAGAATGATCCTGGGTAACAAATGTGATATGAATGACAAAAGACAAGTGT
CAAAAGAAAGAGGGGAGAAGCTAGCAATTGACTATGGGATTAAATTCTTG
GAGACAAGCGCAAAATCCAGTGCAAATGTAGAAGAGGCATTTTTTACACT
TGCACGAGATATAATGACAAAACTCAACAGAAAAATGAATGACAGCAATT
CAGCAGGAGCAGGTGGACCAGTGAAAATAACAGAAAACCGATCAAAGAAG
ACCAGTTTCTTTCGTTGCTCGCTACTTTGAGCGGCCGC
Amino Acid Sequence
MYPYDVPDYAGSMAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFI
STIGIDFKIRTIELDGKKIKLQIWDTAGLERFRTITTAYYRGAMGIMLVY
DITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEK
LAIDYGIKFLETSAKSSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGP
VKITENRSKKTSFFRCSLL*
Vector Type
Mammalian
Antibiotic
Amp
Comments
in pCMV5
100042 R 1000 1001 1047 19007
Enquire Now