Rab8b

Plasmid
pCMV HA RAB8b T22N S111E
Parent Plasmid
pCMV5 HA1
Expressed
HA Rab8b S111E T22N
DU Number
DU43630
Genbank
Q92930
Tag
HA
Species
Human
Sequence of Insert
GGATCCATGGCGAAGACGTACGATTATCTCTTCAAGCTCCTGCTGATCGG
CGACTCGGGGGTAGGCAAGAACTGCCTCCTGTTCCGCTTCTCAGAGGACG
CCTTCAACACCACCTTCATCTCCACCATCGGAATTGATTTTAAAATTAGA
ACGATAGAACTAGATGGAAAGAAAATTAAGCTTCAGATATGGGACACAGC
GGGTCAGGAAAGATTCCGAACAATCACGACAGCGTACTACAGAGGAGCCA
TGGGCATTATGCTGGTCTATGACATCACAAATGAAAAATCCTTTGACAAT
ATTAAAAATTGGATCAGAAACATTGAAGAGCATGCCGAATCCGATGTCGA
AAGAATGATCCTGGGTAACAAATGTGATATGAATGACAAAAGACAAGTGT
CAAAAGAAAGAGGGGAGAAGCTAGCAATTGACTATGGGATTAAATTCTTG
GAGACAAGCGCAAAATCCAGTGCAAATGTAGAAGAGGCATTTTTTACACT
TGCACGAGATATAATGACAAAACTCAACAGAAAAATGAATGACAGCAATT
CAGCAGGAGCAGGTGGACCAGTGAAAATAACAGAAAACCGATCAAAGAAG
ACCAGTTTCTTTCGTTGCTCGCTACTTTGAGCGGCCGC
Amino Acid Sequence
MYPYDVPDYAGSMAKTYDYLFKLLLIGDSGVGKNCLLFRFSEDAFNTTFI
STIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVY
DITNEKSFDNIKNWIRNIEEHAESDVERMILGNKCDMNDKRQVSKERGEK
LAIDYGIKFLETSAKSSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGP
VKITENRSKKTSFFRCSLL*
Vector Type
Mammalian
Antibiotic
Amp
Comments
in pCMV5
100042 R 1000 1001 1047 19007
Enquire Now