Rab8a

Synonyms
GFP-IGG-CAM- Rab8A, (Homo sapiens RAB8A, member RAS oncogene family)
Plasmid
pGEX6P-1 rab8a 91-150
Parent Plasmid
pGEX6P1
Expressed
GST RAB8a 91-150
DU Number
DU43170
Genbank
NM_005370.4
Tag
GST
Species
Human
Sequence of Insert
ggatccACCAACGAGAAGTCCTTCGACAACATCCGGAACTGGATTCGCAACATTGAGGAGCACGCCTCTGCAGACGTCGAAAAGATGATACTCGGGAACAAGTGTGATGTGAATGACAAGAGACAAGTTTCCAAGGAACGGGGAGAAAAGCTGGCCCTCGACTATGGAATCAAGTTCATGGAGACCtaagcggccgc
Amino Acid Sequence
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSTNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMET*
Vector Type
Bacterial
Antibiotic
Amp
Comments
GST fusion of Rab8a from residue 91-150
100042 R 1000 1001 1047 19007
Enquire Now