Rab8b

Plasmid
pGEX6P-1 rab8b 91-150
Parent Plasmid
pGEX6P1
Expressed
GST rab8b 91-150
DU Number
DU43167
Genbank
Q92930
Tag
GST
Species
Human
Sequence of Insert
ggatccacaaatgaaaaatcctttgacaatattaaaaattggatcagaaacattgaagagcatgcctcttccgatgtcgaaagaatgatcctgggtaacaaatgtgatatgaatgacaaaagacaagtgtcaaaagaaagaggggagaagctagcaattgactatgggattaaattcttggagacataagcggccgc
Amino Acid Sequence
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSTNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLET*
Vector Type
Bacterial
Antibiotic
Amp
Comments
GST fusion of Rab8b from residue (91-150)
100042 R 1000 1001 1047 19007
Enquire Now