rab8b

Plasmid
pGEX6P-1 rab8b 91-150 S111A
Parent Plasmid
pGEX6P1
Expressed
GST rab8b 91-150 S111A
DU Number
DU43173
Genbank
Q92930
Tag
GST
Species
Human
Sequence of Insert
ggatccacaaatgaaaaatcctttgacaatattaaaaattggatcagaaacattgaagagcatgccGcttccgatgtcgaaagaatgatcctgggtaacaaatgtgatatgaatgacaaaagacaagtgtcaaaagaaagaggggagaagctagcaattgactatgggattaaattcttggagacataagcggccgc
Amino Acid Sequence
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSTNEKSFDNIKNWIRNIEEHAASDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLET*
Vector Type
Bacterial
Antibiotic
Amp
Comments
GST fusion of Rab8b from residue (91-150) with S111A point mutation
100042 R 1000 1001 1047 19007
Enquire Now