Rab8b

Plasmid
pEBG6P RAB8b Q67L S111E
Parent Plasmid
pEBG6P
Expressed
GST-Rab8b S111E Q67L
DU Number
DU43653
Genbank
Q92930
Tag
GST
Species
Human
Sequence of Insert
GGATCCATGGCGAAGACGTACGATTATCTCTTCAAGCTCCTGCTGATCGG
CGACTCGGGGGTAGGCAAGACCTGCCTCCTGTTCCGCTTCTCAGAGGACG
CCTTCAACACCACCTTCATCTCCACCATCGGAATTGATTTTAAAATTAGA
ACGATAGAACTAGATGGAAAGAAAATTAAGCTTCAGATATGGGACACAGC
GGGTCTGGAAAGATTCCGAACAATCACGACAGCGTACTACAGAGGAGCCA
TGGGCATTATGCTGGTCTATGACATCACAAATGAAAAATCCTTTGACAAT
ATTAAAAATTGGATCAGAAACATTGAAGAGCATGCCGAATCCGATGTCGA
AAGAATGATCCTGGGTAACAAATGTGATATGAATGACAAAAGACAAGTGT
CAAAAGAAAGAGGGGAGAAGCTAGCAATTGACTATGGGATTAAATTCTTG
GAGACAAGCGCAAAATCCAGTGCAAATGTAGAAGAGGCATTTTTTACACT
TGCACGAGATATAATGACAAAACTCAACAGAAAAATGAATGACAGCAATT
CAGCAGGAGCAGGTGGACCAGTGAAAATAACAGAAAACCGATCAAAGAAG
ACCAGTTTCTTTCGTTGCTCGCTACTTTGAGCGGCCGC
Amino Acid Sequence
MAPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL
EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL
DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH
PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA
WPLQGWQATFGGGDHPPKSDLVPRGSLEVLFQGPLGSMAKTYDYLFKLLL
IGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWD
TAGLERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHAESD
VERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAKSSANVEEAFF
TLARDIMTKLNRKMNDSNSAGAGGPVKITENRSKKTSFFRCSLL*
Vector Type
Mammalian
Antibiotic
Amp
Comments
in pEBG
100042 R 1000 1001 1047 19007
Enquire Now