RAB8B

Plasmid
pEBG RAB8B
Parent Plasmid
pEBG6P
Expressed
GST-RAB8B
DU Number
DU41893
Genbank
NM_016530.2
Tag
GST
Species
Human
Sequence of Insert
GGATCCATGGCGAAGACGTACGATTATCTCTTCAAGCTCCTGCTGATCGGCGACTCGGGGGTAGGCAAGACCTGCCTCCTGTTCCGCTTCTCAGAGGACGCCTTCAACACCACCTTCATCTCCACCATCGGAATTGATTTTAAAATTAGAACGATAGAACTAGATGGAAAGAAAATTAAGCTTCAGATATGGGACACAGCGGGTCAGGAAAGATTCCGAACAATCACGACAGCGTACTACAGAGGAGCCATGGGCATTATGCTGGTCTATGACATCACAAATGAAAAATCCTTTGACAATATTAAAAATTGGATCAGAAACATTGAAGAGCATGCCTCTTCCGATGTCGAAAGAATGATCCTGGGTAACAAATGTGATATGAATGACAAAAGACAAGTGTCAAAAGAAAGAGGGGAGAAGCTAGCAATTGACTATGGGATTAAATTCTTGGAGACAAGCGCAAAATCCAGTGCAAATGTAGAAGAGGCATTTTTTACACTTGCACGAGATATAATGACAAAACTCAACAGAAAAATGAATGACAGCAATTCAGCAGGAGCAGGTGGACCAGTGAAAATAACAGAAAACCGATCAAAGAAGACCAGTTTCTTTCGTTGCTCGCTACTTTGAGCGGCCGC
Amino Acid Sequence
MAPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSLEVLFQGPLGSMAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAKSSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGPVKITENRSKKTSFFRCSLL*
Vector Type
Mammalian
Antibiotic
Amp
100042 R 1000 1001 1047 19007
Enquire Now