Rab8b

Plasmid
pGEX6P-1 rab8b
Parent Plasmid
pGEX6P1
Expressed
GST RAB8b
DU Number
DU39852
Genbank
Q92930
Tag
GST
Species
Human
Sequence of Insert
GGATCCatggcgaagacgtacgattatctcttcaagctcctgctgatcgg
cgactcgggggtaggcaagacctgcctcctgttccgcttctcagaggacg
ccttcaacaccaccttcatctccaccatcggaattgattttaaaattaga
acgatagaactagatggaaagaaaattaagcttcagatatgggacacagc
gggtcaggaaagattccgaacaatcacgacagcgtactacagaggagcca
tgggcattatgctggtctatgacatcacaaatgaaaaatcctttgacaat
attaaaaattggatcagaaacattgaagagcatgcctcttccgatgtcga
aagaatgatcctgggtaacaaatgtgatatgaatgacaaaagacaagtgt
caaaagaaagaggggagaagctagcaattgactatgggattaaattcttg
gagacaagcgcaaaatccagtgcaaatgtagaagaggcattttttacact
tgcacgagatataatgacaaaactcaacagaaaaatgaatgacagcaatt
cagcaggagcaggtggaccagtgaaaataacagaaaaccgatcaaagaag
accagtttctttcgttgctcgctactttgaGCGGCCGC
Amino Acid Sequence
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL
EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL
DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH
PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA
WPLQGWQATFGGGDHPPKSDLEVLFQGPLGSMAKTYDYLFKLLLIGDSGV
GKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQER
FRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMIL
GNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAKSSANVEEAFFTLARDI
MTKLNRKMNDSNSAGAGGPVKITENRSKKTSFFRCSLL*
Vector Type
Bacterial
Antibiotic
Amp
100042 R 1000 1001 1047 19007
Enquire Now