aPINK1

Synonyms
anti-PINK1 nanobody
Plasmid
pMERI aPINK1 nano3 c-HIS
Parent Plasmid
pMERI
Expressed
pelB-MBP-3C-aPINK1 nano3-6HIS
DU Number
DU60329
Tag
6His
MBP
Species
Human
Sequence of Insert
ggatcccgcgtgcagctggtggaaagcggcggcggcctggtgcaggcgggcggcagcctgaaactgagctgcaccaccagcggtcgcccgtttagctgctttgatctggcgtggtttcgccaggcgccgggcaaagaacgcgaatttgtgagcggcctgcgccgcggcggcagcaccttttatgcggatagcgtgagcggacgctttaccattagcggcggcagcacctgcctgaccctgtatctgcagatgaacagcctgaaaccggaagataccgcgatttattattgcgcgcgcagcattaccggctatggcctggtggatagcgcgagccattataccatttggggccagggcacccaggtgcaggtgcagagccatcatcatcatcatcatgaaccggaagcgtgagcggccgc
Amino Acid Sequence
MKYLLPTAAAGLLLLAAQPAMAKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAE
ITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDI
KDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKE
FLENYLLTDEGLEAVNKDKPLGAVALKSYEEELVKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSSNNNNNNNN
NNLGDDDDKVPEFLEVLFQGPLGSRVQLVESGGGLVQAGGSLKLSCTTSGRPFSCFDLAWFRQAPGKEREFVSGLRRGGSTFYADSVSGRFTISGGSTCL
TLYLQMNSLKPEDTAIYYCARSITGYGLVDSASHYTIWGQGTQVQVQSHHHHHHEPEA*
Vector Type
Bacterial
Antibiotic
Amp
Comments
Anti-PINK1 nanobody for use in degron generation.
100042 R 1000 1001 1047 19007
Enquire Now