Rab10

Plasmid
pAS2.6 Rab10
Parent Plasmid
pAS2.6
Expressed
GAL4-DNA-BD Rab10
DU Number
DU16428
Genbank
NM_016131.3 GI:142365829*
Tag
GAL4 DNA-BD
Species
Human
Sequence of Insert
GGATCCATGGCGAAGAAGACGTACGACCTGCTTTTCAAGCTGCTCCTGATCGGGGATTCCGGAGTGGGGAAGACCTGCGTCCTTTTTCGTTTTTCGGATGATGCCTTCAATACTACCTTTATTTCCACCATAGGAATAGACTTCAAGATCAAAACAGTTGAATTACAAGGAAAGAAGATCAAGCTACAGATATGGGATACAGCAGGCCAGGAGCGATTTCACACCATCACAACCTCCTACTACAGAGGCGCAATGGGTATCATGCTAGTATATGACATCACCAATGGTAAAAGTTTTGAAAACATC
AGCAAATGGCTTAGAAACATAGATGAGCATGCCAATGAAGATGTGGAAAG
AATGTTACTAGGAAACAAGTGTGATATGGACGACAAAAGAGTTGTACCTA
AAGGAAAAGGAGAACAGATTGCAAGGGAGCATGGTATTAGGTTTTTTGAG
ACTAGTGCAAAAGCAAATATAAACATCGAAAAGGCGTTCCTCACGTTAGC
TGAAGATATCCTTCGAAAGACCCCTGTAAAAGAGCCCAACAGTGAAAATG
TAGATATCAGCAGTGGAGGAGGCGTGACAGGCTGGAAGAGCAAATGCTGC
TGAGCGGCCGC
Amino Acid Sequence
MKLLSSIEQACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPKTKRSPLT
RAHLTEVESRLERLEQLFLLIFPREDLDMILKMDSLQDIKALLTGLFVQD
NVNKDAVTDRLASVETDMPLTLRQHRISATSSSEESSNKGQRQLTVSPVL
QYPALTHMGSMAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKGKGEQIAREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPNSENVDISSGGGVTGWKSKCC*

Vector Type
Other
Antibiotic
Amp
Comments
Sequence differences compared with NM_016131.3 CDS:
g360a (silent), g413a (G138E- present in many other published RNAs)
100042 R 1000 1001 1047 19007
Enquire Now