Rab10

Plasmid
pETBlue2-6His Rab10
Parent Plasmid
pETBlue2 6His
Expressed
6His Rab10
DU Number
DU16105
Genbank
NM_016131.3 GI:142365829*
Tag
6His
Species
Human
Sequence of Insert
GGATCCATGGCGAAGAAGACGTACGACCTGCTTTTCAAGCTGCTCCTGATCGGGGATTCCGGAGTGGGGAAGACCTGCGTCCTTTTTCGTTTTTCGGATGATGCCTTCAATACTACCTTTATTTCCACCATAGGAATAGACTTCAAGATCAAAACAGTTGAATTACAAGGAAAGAAGATCAAGCTACAGATATGGGATACAGCAGGCCAGGAGCGATTTCACACCATCACAACCTCCTACTACAGAGGCGCAATGGGTATCATGCTAGTATATGACATCACCAATGGTAAAAGTTTTGAAAACATC
AGCAAATGGCTTAGAAACATAGATGAGCATGCCAATGAAGATGTGGAAAG
AATGTTACTAGGAAACAAGTGTGATATGGACGACAAAAGAGTTGTACCTA
AAGGAAAAGGAGAACAGATTGCAAGGGAGCATGGTATTAGGTTTTTTGAG
ACTAGTGCAAAAGCAAATATAAACATCGAAAAGGCGTTCCTCACGTTAGC
TGAAGATATCCTTCGAAAGACCCCTGTAAAAGAGCCCAACAGTGAAAATG
TAGATATCAGCAGTGGAGGAGGCGTGACAGGCTGGAAGAGCAAATGCTGC
TGAGCGGCCGC
Amino Acid Sequence
MGHHHHHHLGSMAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFI
STIGIDFKIKTVELQGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVY
DITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKGKGEQ
IAREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPNSENVDISSG
GGVTGWKSKCC*
Vector Type
Bacterial
Antibiotic
Amp
Comments
Bacterial construct.
Sequence differences compared with NM_016131.3 CDS:
g360a (silent), g413a (G138E- present in many other published RNAs)
100042 R 1000 1001 1047 19007
Enquire Now