Rab8A

Plasmid
pETBlue2-6His Rab8A
Parent Plasmid
pETBlue2 6His
Expressed
6His Rab8A
DU Number
DU16106
Genbank
NM_005370.4 GI:40548385
Tag
6His
Species
Human
Sequence of Insert
GGATCCATGGCGAAGACCTACGATTACCTGTTCAAGCTGCTGCTGATCGG
GGACTCGGGGGTGGGGAAGACCTGTGTCCTGTTCCGCTTCTCCGAGGACG
CCTTCAACTCCACTTTTATCTCCACCATAGGAATTGACTTTAAAATTAGG
ACCATAGAGCTCGATGGCAAGAGAATTAAACTGCAGATATGGGACACAGC
CGGTCAGGAACGGTTTCGGACGATCACAACGGCCTACTACAGGGGTGCAA
TGGGCATCATGCTGGTCTACGACATCACCAACGAGAAGTCCTTCGACAAC
ATCCGGAACTGGATTCGCAACATTGAGGAGCACGCCTCTGCAGACGTCGA
AAAGATGATACTCGGGAACAAGTGTGATGTGAATGACAAGAGACAAGTTT
CCAAGGAACGGGGAGAAAAGCTGGCCCTCGACTATGGAATCAAGTTCATG
GAGACCAGCGCGAAGGCCAACATCAATGTGGAAAATGCATTTTTCACTCT
CGCCAGAGATATCAAAGCAAAAATGGACAAAAAATTGGAAGGCAACAGCC
CCCAGGGGAGCAACCAGGGAGTCAAAATCACACCGGACCAGCAGAAGAGG
AGCAGCTTTTTCCGATGTGTTCTTCTGTGAGCGGCCGC
Amino Acid Sequence
MGHHHHHHLGSMAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFIS
TIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYD
ITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKL
ALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGV
KITPDQQKRSSFFRCVLL*
Vector Type
Bacterial
Antibiotic
Amp
Comments
Bacterial construct.
100042 R 1000 1001 1047 19007
Enquire Now